PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000679946
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 338aa    MW: 38845.4 Da    PI: 5.8554
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000679946genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM160.75.7e-501833082128
            NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                    +pGfrFhPt+eelv +yL++kvegk++++ e i+ +d+y+++Pw+Lp++++ +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ + s++ 
  MDP0000679946 183 MPGFRFHPTEEELVEFYLRRKVEGKRFNV-ELITFLDLYRYDPWELPAMAAIGEKEWFFYVPRDRKYRNGDRPNRVTTSGYWKATGADRMIRSENF 277
                    79***************************.89***************888889******************************************* PP

            NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                    + +glkktLvfy+g+apkg +t+W+m+eyrl
  MDP0000679946 278 RSIGLKKTLVFYSGKAPKGIRTSWIMNEYRL 308
                    *****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF530984.05E-128132IPR012337Ribonuclease H-like domain
Gene3DG3DSA:3.30.420.105.7E-89130IPR012337Ribonuclease H-like domain
CDDcd062221.42E-1911130No hitNo description
PfamPF134561.0E-2412131No hitNo description
SuperFamilySSF1019412.22E-52182315IPR003441NAC domain
PROSITE profilePS5100551.177182326IPR003441NAC domain
PfamPF023657.4E-25184308IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 338 aa     Download sequence    Send to blast
MENTTVGTLK VNCDAAWNPQ SHKGGVGWVI RNFAGLLHSA GGRENLYRSV EIVEATALRA  60
ALQECAKKDI DSIEIETDAK TIMQMINKET GTEASLEDII HDIWNLAQTF QNATLTYAHR  120
ECNHAARAVA SYVSKDGSFM AVAETTTTSS SSTMSHDDSN KADHDHEHEH DEYVDEHEHD  180
MVMPGFRFHP TEEELVEFYL RRKVEGKRFN VELITFLDLY RYDPWELPAM AAIGEKEWFF  240
YVPRDRKYRN GDRPNRVTTS GYWKATGADR MIRSENFRSI GLKKTLVFYS GKAPKGIRTS  300
WIMNEYRLPH HETERYQKTL WDFFLDLPTD SLGLLEY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-5218430819142NAC domain-containing protein 19
4dul_A2e-5218430819142NAC domain-containing protein 19
1ut7_B2e-5218430819142NO APICAL MERISTEM PROTEIN
1ut7_A2e-5218430819142NO APICAL MERISTEM PROTEIN
1ut4_B2e-5218430819142NO APICAL MERISTEM PROTEIN
1ut4_A2e-5218430819142NO APICAL MERISTEM PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00257DAPTransfer from AT2G02450Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2707921e-119AB270792.1 Malus x domestica MdSFBB9-alpha, S9-RNase, MdSFBB9-beta genes, complete cds, Psi-SFBB9-alpha, Psi-SFBB9-beta pseudogenes.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008339444.11e-131PREDICTED: NAC domain-containing protein 55-like
RefseqXP_008382796.11e-132PREDICTED: putative NAC domain-containing protein 94
TrEMBLA0A0B2P2K81e-104A0A0B2P2K8_GLYSO; Putative NAC domain-containing protein 94
TrEMBLK7MJ701e-104K7MJ70_SOYBN; Uncharacterized protein
STRINGGLYMA17G00650.21e-103(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF72033146
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.16e-97NAC domain containing protein 35